PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 29465.1 Da    PI: 10.2061
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001631.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.71.7e-29959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye++s
  Do001631.1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFAS 59
                79***********************************************86 PP

2K-box70.64.9e-2479171698
       K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 ++++++++ ++ + ++  L +++e L++++R++lGe+Le++s++eL++Le +Leksl  iR kK++ll +qi +l++ke+ l ++nk+Lr+k+
  Do001631.1  79 SNKAAQHDIQQVKADALSLANRLEALEKSKRKFLGENLEDCSVEELHSLEVKLEKSLHVIRGKKTQLLEQQIAKLKEKERTLLKDNKELREKV 171
                 344788889**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.483161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-32385IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-30323IPR002100Transcription factor, MADS-box
CDDcd002656.94E-41379No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2584171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.14887177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIVFSP RGKLYEFASA  60
TSLQKTIDRY KAYTRENLSN KAAQHDIQQV KADALSLANR LEALEKSKRK FLGENLEDCS  120
VEELHSLEVK LEKSLHVIRG KKTQLLEQQI AKLKEKERTL LKDNKELREK VIAINHLVSV  180
KHLRSVKYPI SYILIYHSLL LSLQQRNVQP PLVAPGPNRC LPPWPRNLPA PCNNDMDVET  240
ELYIGLPGRE RSSNRDSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A6e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D6e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A6e-17373271Myocyte-specific enhancer factor 2A
3kov_B6e-17373271Myocyte-specific enhancer factor 2A
3kov_I6e-17373271Myocyte-specific enhancer factor 2A
3kov_J6e-17373271Myocyte-specific enhancer factor 2A
3p57_A6e-17373271Myocyte-specific enhancer factor 2A
3p57_B6e-17373271Myocyte-specific enhancer factor 2A
3p57_C6e-17373271Myocyte-specific enhancer factor 2A
3p57_D6e-17373271Myocyte-specific enhancer factor 2A
3p57_I6e-17373271Myocyte-specific enhancer factor 2A
3p57_J6e-17373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0648230.0BT064823.1 Zea mays full-length cDNA clone ZM_BFb0180I10 mRNA, complete cds.
GenBankKJ7269280.0KJ726928.1 Zea mays clone pUT3473 MADS transcription factor (MADS76) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-143PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-103MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-131C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-134(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-67AGAMOUS-like 20